Lineage for d1oi4b_ (1oi4 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579489Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 579594Family c.23.16.2: DJ-1/PfpI [52325] (7 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 579644Protein Hypothetical protein YhbO [89601] (1 species)
  7. 579645Species Escherichia coli [TaxId:562] [89602] (1 PDB entry)
  8. 579647Domain d1oi4b_: 1oi4 B: [87048]
    structural genomics

Details for d1oi4b_

PDB Entry: 1oi4 (more details), 2.03 Å

PDB Description: crystal structure of yhbo from escherichia coli

SCOP Domain Sequences for d1oi4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi4b_ c.23.16.2 (B:) Hypothetical protein YhbO {Escherichia coli}
aglskkiavlitdefedseftspadefrkaghevitiekqagktvkgkkgeasvtidksi
devtpaefdalllpgghspdylrgdnrfvtftrdfvnsgkpvfaichgpqllisadvirg
rkltavkpiiidvknagaefydqevvvdkdqlvtsrtpddlpafnrealrllga

SCOP Domain Coordinates for d1oi4b_:

Click to download the PDB-style file with coordinates for d1oi4b_.
(The format of our PDB-style files is described here.)

Timeline for d1oi4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oi4a_