SCOP 1.67: Domain d1oi4b_: 1oi4 B:

Lineage for d1oi4b_ (1oi4 B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (6 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein Hypothetical protein YhbO [89601] (1 species)

7. Species Escherichia coli [TaxId:562] [89602] (1 PDB entry)

8. Domain d1oi4b_: 1oi4 B: [87048]
   structural genomics

Details for d1oi4b_

PDB Entry: 1oi4, 2.03 Å

PDB Description: crystal structure of yhbo from escherichia coli

SCOP Domain Sequences for d1oi4b_:

Sequence; same for both SEQRES and ATOM records:

>d1oi4b_ c.23.16.2 (B:) Hypothetical protein YhbO {Escherichia coli}
aglskkiavlitdefedseftspadefrkaghevitiekqagktvkgkkgeasvtidksi
devtpaefdalllpgghspdylrgdnrfvtftrdfvnsgkpvfaichgpqllisadvirg
rkltavkpiiidvknagaefydqevvvdkdqlvtsrtpddlpafnrealrllga

Timeline for d1oi4b_:

• d1oi4b_ first appeared in SCOP 1.65
  
• d1oi4b_ appears in SCOP 1.69
  
• d1oi4b_ last appears in SCOP 1.73