Lineage for d1oi4a_ (1oi4 A:)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families) 
conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures
Family c.23.16.2: DJ-1/PfpI [52325] (3 proteins)
contains a catalytic Cys-His-Glu triad that differs from the class I GAT triad
Protein Hypothetical protein YhbO [89601] (1 species) Species Escherichia coli [TaxId:562] [89602] (1 PDB entry) 
Domain d1oi4a_: 1oi4 A: [87047]
Details for d1oi4a_
PDB Entry: 1oi4 (more details), 2.03 Å
PDB Description: crystal structure of yhbo from escherichia coli
SCOP Domain Sequences for d1oi4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oi4a_ c.23.16.2 (A:) Hypothetical protein YhbO {Escherichia coli}
syyhhhhhhlestslykkaglskkiavlitdefedseftspadefrkaghevitiekqag
ktvkgkkgeasvtidksidevtpaefdalllpgghspdylrgdnrfvtftrdfvnsgkpv
faichgpqllisadvirgrkltavkpiiidvknagaefydqevvvdkdqlvtsrtpddlp
afnrealrllga
SCOP Domain Coordinates for d1oi4a_:
Click to download the PDB-style file with coordinates for d1oi4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oi4a_:
- d1oi4a_ is new in SCOP 1.65
- d1oi4a_ appears in SCOP 1.67
- d1oi4a_ last appears in SCOP 1.73
View in 3D
