Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families) conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (3 proteins) contains a catalytic Cys-His-Glu triad that differs from the class I GAT triad |
Protein Hypothetical protein YhbO [89601] (1 species) |
Species Escherichia coli [TaxId:562] [89602] (1 PDB entry) |
Domain d1oi4a_: 1oi4 A: [87047] |
PDB Entry: 1oi4 (more details), 2.03 Å
SCOP Domain Sequences for d1oi4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oi4a_ c.23.16.2 (A:) Hypothetical protein YhbO {Escherichia coli} syyhhhhhhlestslykkaglskkiavlitdefedseftspadefrkaghevitiekqag ktvkgkkgeasvtidksidevtpaefdalllpgghspdylrgdnrfvtftrdfvnsgkpv faichgpqllisadvirgrkltavkpiiidvknagaefydqevvvdkdqlvtsrtpddlp afnrealrllga
Timeline for d1oi4a_: