Lineage for d1oi1a2 (1oi1 A:140-243)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372967Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 372983Family b.34.9.3: MBT repeat [89299] (2 proteins)
    contains extended 'arm', N-terminal to the common fold core
  6. 373007Protein Scml2 protein [89300] (1 species)
    duplication: contains tandem repeat of two MBT repeats
  7. 373008Species Human (Homo sapiens) [TaxId:9606] [89301] (1 PDB entry)
  8. 373010Domain d1oi1a2: 1oi1 A:140-243 [87038]
    complexed with peg; mutant

Details for d1oi1a2

PDB Entry: 1oi1 (more details), 1.78 Å

PDB Description: crystal structure of the mbt domains of human scml2

SCOP Domain Sequences for d1oi1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens)}
swpmflletlngsemasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkg
devhitfdgwsgafdywckydsrdifpagwcrltgdvlqppgts

SCOP Domain Coordinates for d1oi1a2:

Click to download the PDB-style file with coordinates for d1oi1a2.
(The format of our PDB-style files is described here.)

Timeline for d1oi1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi1a1