Lineage for d1ohla_ (1ohl A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385592Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 385861Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 385862Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 385863Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (11 PDB entries)
  8. 385864Domain d1ohla_: 1ohl A: [87035]
    complexed with bme, pbg, zn

Details for d1ohla_

PDB Entry: 1ohl (more details), 1.6 Å

PDB Description: yeast 5-aminolaevulinic acid dehydratase putative cyclic reaction intermediate complex

SCOP Domain Sequences for d1ohla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohla_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae)}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshqgflragarliitylapefldwlde

SCOP Domain Coordinates for d1ohla_:

Click to download the PDB-style file with coordinates for d1ohla_.
(The format of our PDB-style files is described here.)

Timeline for d1ohla_: