![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (5 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein) hybrid of classes I and II aldolase |
![]() | Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (11 PDB entries) |
![]() | Domain d1ohla_: 1ohl A: [87035] complexed with bme, pbg, zn |
PDB Entry: 1ohl (more details), 1.6 Å
SCOP Domain Sequences for d1ohla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohla_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae)} mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa ekgvvdlktiafeshqgflragarliitylapefldwlde
Timeline for d1ohla_: