SCOP 1.65: Domain d1ohhg_: 1ohh G:

Lineage for d1ohhg_ (1ohh G:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (1 family)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)

6. Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52946] (10 PDB entries)

8. Domain d1ohhg_: 1ohh G: [87033]
   Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhh_
   core domain is disordered; only coiled coil part is visible
   complexed with anp, mg

Details for d1ohhg_

PDB Entry: 1ohh, 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohhg_:

Sequence, based on SEQRES records:

>d1ohhg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records):

>d1ohhg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaaklcgaihssvakqttseqsarmtamdnaskn
asemidkltltfnrtrqavitkelieiisgaaal

Timeline for d1ohhg_:

• d1ohhg_ is new in SCOP 1.65
  
• d1ohhg_ appears in SCOP 1.67
  
• d1ohhg_ appears in the current release, SCOPe 2.08