Lineage for d1ohhf2 (1ohh F:9-81)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466323Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 466324Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 466325Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 466371Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 466374Species Cow (Bos taurus) [TaxId:9913] [88678] (12 PDB entries)
  8. 466407Domain d1ohhf2: 1ohh F:9-81 [87031]
    Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd3, d1ohhe1, d1ohhe3, d1ohhf1, d1ohhf3, d1ohhg_, d1ohhh_

Details for d1ohhf2

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohhf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohhf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1ohhf2:

Click to download the PDB-style file with coordinates for d1ohhf2.
(The format of our PDB-style files is described here.)

Timeline for d1ohhf2: