SCOP 1.65: Domain d1ohhf2: 1ohh F:9-81

Lineage for d1ohhf2 (1ohh F:9-81)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (10 PDB entries)

8. Domain d1ohhf2: 1ohh F:9-81 [87031]
   Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd3, d1ohhe1, d1ohhe3, d1ohhf1, d1ohhf3, d1ohhg_, d1ohhh_
   complexed with anp, mg

Details for d1ohhf2

PDB Entry: 1ohh, 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohhf2:

Sequence; same for both SEQRES and ATOM records:

>d1ohhf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1ohhf2:

• d1ohhf2 is new in SCOP 1.65
  
• d1ohhf2 appears in SCOP 1.67
  
• d1ohhf2 appears in the current release, SCOPe 2.08