| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
| Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88780] (10 PDB entries) |
| Domain d1ohhe3: 1ohh E:82-357 [87029] Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhe1, d1ohhe2, d1ohhf1, d1ohhf2, d1ohhg_, d1ohhh_ |
PDB Entry: 1ohh (more details), 2.8 Å
SCOP Domain Sequences for d1ohhe3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohhe3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1ohhe3: