Lineage for d1ohhd1 (1ohh D:358-477)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357519Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 357520Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 357521Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 357561Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 357564Species Cow (Bos taurus) [TaxId:9913] [88929] (10 PDB entries)
  8. 357589Domain d1ohhd1: 1ohh D:358-477 [87024]
    Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd2, d1ohhd3, d1ohhe2, d1ohhe3, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_

Details for d1ohhd1

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohhd1 a.69.1.1 (D:358-477) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklaeeh

SCOP Domain Coordinates for d1ohhd1:

Click to download the PDB-style file with coordinates for d1ohhd1.
(The format of our PDB-style files is described here.)

Timeline for d1ohhd1: