| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
| Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88775] (12 PDB entries) |
| Domain d1ohhc3: 1ohh C:95-379 [87023] Other proteins in same PDB: d1ohha1, d1ohha2, d1ohhb1, d1ohhb2, d1ohhc1, d1ohhc2, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_ |
PDB Entry: 1ohh (more details), 2.8 Å
SCOP Domain Sequences for d1ohhc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohhc3 c.37.1.11 (C:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d1ohhc3: