| Class b: All beta proteins [48724] (144 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88673] (12 PDB entries) |
| Domain d1ohhb2: 1ohh B:24-94 [87019] Other proteins in same PDB: d1ohha1, d1ohha3, d1ohhb1, d1ohhb3, d1ohhc1, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_ |
PDB Entry: 1ohh (more details), 2.8 Å
SCOP Domain Sequences for d1ohhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohhb2 b.49.1.1 (B:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai
Timeline for d1ohhb2: