| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.69: Left-handed superhelix [47916] (3 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) ![]() |
| Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
| Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88893] (10 PDB entries) |
| Domain d1ohha1: 1ohh A:380-510 [87015] Other proteins in same PDB: d1ohha2, d1ohha3, d1ohhb2, d1ohhb3, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_ |
PDB Entry: 1ohh (more details), 2.8 Å
SCOP Domain Sequences for d1ohha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohha1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea
Timeline for d1ohha1: