Lineage for d1ohea1 (1ohe A:42-198)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991569Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 991570Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 991571Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 991593Protein Proline directed phosphatase CDC14b2 [89698] (1 species)
    duplication: consists of two structurally similar domains with the catalytic site being in the C-terminal domain
  7. 991594Species Human (Homo sapiens) [TaxId:9606] [89699] (3 PDB entries)
  8. 991595Domain d1ohea1: 1ohe A:42-198 [87013]

Details for d1ohea1

PDB Entry: 1ohe (more details), 2.2 Å

PDB Description: structure of cdc14b phosphatase with a peptide ligand
PDB Compounds: (A:) cdc14b2 phosphatase

SCOPe Domain Sequences for d1ohea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]}
rdpqddvylditdrlcfailysrpksasnvhyfsidneleyenfyadfgplnlamvyryc
ckinkklksitmlrkkivhftgsdqrkqanaaflvgcymviylgrtpeeayrilifgets
yipfrdaaygscnfyitlldcfhavkkamqygflnfn

SCOPe Domain Coordinates for d1ohea1:

Click to download the PDB-style file with coordinates for d1ohea1.
(The format of our PDB-style files is described here.)

Timeline for d1ohea1: