![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
![]() | Protein Proline directed phosphatase CDC14b2 [89698] (1 species) duplication: consists of two structurally similar domains with the catalytic site being in the C-terminal domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89699] (3 PDB entries) |
![]() | Domain d1ohea1: 1ohe A:42-198 [87013] |
PDB Entry: 1ohe (more details), 2.2 Å
SCOPe Domain Sequences for d1ohea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} rdpqddvylditdrlcfailysrpksasnvhyfsidneleyenfyadfgplnlamvyryc ckinkklksitmlrkkivhftgsdqrkqanaaflvgcymviylgrtpeeayrilifgets yipfrdaaygscnfyitlldcfhavkkamqygflnfn
Timeline for d1ohea1: