SCOP 1.65: Domain d1ohea1: 1ohe A:42-198

Lineage for d1ohea1 (1ohe A:42-198)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (6 proteins)

6. Protein Proline directed phosphatase CDC14b2 [89698] (1 species)
   duplication: consists of two structurally similar domains with the catalytic site being in the C-terminal domain

7. Species Human (Homo sapiens) [TaxId:9606] [89699] (3 PDB entries)

8. Domain d1ohea1: 1ohe A:42-198 [87013]

Details for d1ohea1

PDB Entry: 1ohe, 2.2 Å

PDB Description: structure of cdc14b phosphatase with a peptide ligand

SCOP Domain Sequences for d1ohea1:

Sequence; same for both SEQRES and ATOM records:

>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens)}
rdpqddvylditdrlcfailysrpksasnvhyfsidneleyenfyadfgplnlamvyryc
ckinkklksitmlrkkivhftgsdqrkqanaaflvgcymviylgrtpeeayrilifgets
yipfrdaaygscnfyitlldcfhavkkamqygflnfn

Timeline for d1ohea1:

• d1ohea1 is new in SCOP 1.65
  
• d1ohea1 appears in SCOP 1.67
  
• d1ohea1 appears in the current release, SCOPe 2.08