SCOP 1.75: Domain d1ohda2: 1ohd A:199-379

Lineage for d1ohda2 (1ohd A:199-379)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)

6. Protein Proline directed phosphatase CDC14b2 [89698] (1 species)
   duplication: consists of two structurally similar domains with the catalytic site being in the C-terminal domain

7. Species Human (Homo sapiens) [TaxId:9606] [89699] (3 PDB entries)

8. Domain d1ohda2: 1ohd A:199-379 [87012]
   complexed with wo4

Details for d1ohda2

PDB Entry: 1ohd, 2.6 Å

PDB Description: structure of cdc14 in complex with tungstate

PDB Compounds: (A:) cdc14b2 phosphatase

SCOP Domain Sequences for d1ohda2:

Sequence; same for both SEQRES and ATOM records:

>d1ohda2 c.45.1.1 (A:199-379) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]}
sfnldeyehyekaengdlnwiipdrfiafcgphsrarlesgyhqhspetyiqyfknhnvt
tiirlnkrmydakrftdagfdhhdlffadgstptdaivkefldicenaegaiavhckagl
grtgtliacyimkhyrmtaaetiawvricrpgsvigpqqqflvmkqtnlwlegdyfrqkl
k

Timeline for d1ohda2:

• d1ohda2 first appeared in SCOP 1.65
  
• d1ohda2 appears in SCOP 1.73
  
• d1ohda2 appears in SCOPe 2.01
  
• d1ohda2 appears in the current release, SCOPe 2.08