Lineage for d1ohda1 (1ohd A:42-198)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315136Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432
  4. 315137Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 315138Family c.45.1.1: Dual specificity phosphatase-like [52800] (6 proteins)
  6. 315161Protein Proline directed phosphatase CDC14b2 [89698] (1 species)
    duplication: consists of two structurally similar domains with the catalytic site being in the C-terminal domain
  7. 315162Species Human (Homo sapiens) [TaxId:9606] [89699] (3 PDB entries)
  8. 315167Domain d1ohda1: 1ohd A:42-198 [87011]

Details for d1ohda1

PDB Entry: 1ohd (more details), 2.6 Å

PDB Description: structure of cdc14 in complex with tungstate

SCOP Domain Sequences for d1ohda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohda1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens)}
rdpqddvylditdrlcfailysrpksasnvhyfsidneleyenfyadfgplnlamvyryc
ckinkklksitmlrkkivhftgsdqrkqanaaflvgcymviylgrtpeeayrilifgets
yipfrdaaygscnfyitlldcfhavkkamqygflnfn

SCOP Domain Coordinates for d1ohda1:

Click to download the PDB-style file with coordinates for d1ohda1.
(The format of our PDB-style files is described here.)

Timeline for d1ohda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ohda2