Lineage for d1ohca2 (1ohc A:199-380)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486243Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 486244Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 486245Family c.45.1.1: Dual specificity phosphatase-like [52800] (7 proteins)
  6. 486267Protein Proline directed phosphatase CDC14b2 [89698] (1 species)
    duplication: consists of two structurally similar domains with the catalytic site being in the C-terminal domain
  7. 486268Species Human (Homo sapiens) [TaxId:9606] [89699] (3 PDB entries)
  8. 486272Domain d1ohca2: 1ohc A:199-380 [87010]

Details for d1ohca2

PDB Entry: 1ohc (more details), 2.5 Å

PDB Description: structure of the proline directed phosphatase cdc14

SCOP Domain Sequences for d1ohca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohca2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens)}
sfnldeyehyekaengdlnwiipdrfiafcgphsrarlesgyhqhspetyiqyfknhnvt
tiirlnkrmydakrftdagfdhhdlffadgstptdaivkefldicenaegaiavhckagl
grtgtliacyimkhyrmtaaetiawvricrpgsvigpqqqflvmkqtnlwlegdyfrqkl
kg

SCOP Domain Coordinates for d1ohca2:

Click to download the PDB-style file with coordinates for d1ohca2.
(The format of our PDB-style files is described here.)

Timeline for d1ohca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ohca1