SCOP 1.75: Domain d1ohca1: 1ohc A:42-198

Lineage for d1ohca1 (1ohc A:42-198)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)

6. Protein Proline directed phosphatase CDC14b2 [89698] (1 species)
   duplication: consists of two structurally similar domains with the catalytic site being in the C-terminal domain

7. Species Human (Homo sapiens) [TaxId:9606] [89699] (3 PDB entries)

8. Domain d1ohca1: 1ohc A:42-198 [87009]

Details for d1ohca1

PDB Entry: 1ohc, 2.5 Å

PDB Description: structure of the proline directed phosphatase cdc14

PDB Compounds: (A:) cdc14b2 phosphatase

SCOP Domain Sequences for d1ohca1:

Sequence; same for both SEQRES and ATOM records:

>d1ohca1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]}
rdpqddvylditdrlcfailysrpksasnvhyfsidneleyenfyadfgplnlamvyryc
ckinkklksitmlrkkivhftgsdqrkqanaaflvgcymviylgrtpeeayrilifgets
yipfrdaaygscnfyitlldcfhavkkamqygflnfn

Timeline for d1ohca1:

• d1ohca1 first appeared in SCOP 1.65
  
• d1ohca1 appears in SCOP 1.73
  
• d1ohca1 appears in SCOPe 2.01
  
• d1ohca1 appears in the current release, SCOPe 2.08