SCOP 1.73: Domain d1ogxb_: 1ogx B:

Lineage for d1ogxb_ (1ogx B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (13 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (20 PDB entries)

8. Domain d1ogxb_: 1ogx B: [87003]
   complexed with equ; mutant

Details for d1ogxb_

PDB Entry: 1ogx, 2 Å

PDB Description: high resolution crystal structure of ketosteroid isomerase mutant d40n(d38n, ti numbering) from pseudomonas putida complexed with equilenin at 2.0 a resolution.

PDB Compounds: (B:) steroid delta-isomerase

SCOP Domain Sequences for d1ogxb_:

Sequence; same for both SEQRES and ATOM records:

>d1ogxb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Timeline for d1ogxb_:

• d1ogxb_ first appeared in SCOP 1.65
  
• d1ogxb_ appears in SCOP 1.71
  
• d1ogxb_ appears in SCOP 1.75
  
• d1ogxb_ appears in the current release, SCOPe 2.08