Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Glucosylceramidase [89389] (1 species) glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core |
Species Human (Homo sapiens) [TaxId:9606] [89390] (17 PDB entries) |
Domain d1ogsa1: 1ogs A:1-77,A:432-497 [86997] Other proteins in same PDB: d1ogsa2, d1ogsb2 complexed with nag, so4 |
PDB Entry: 1ogs (more details), 2 Å
SCOPe Domain Sequences for d1ogsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogsa1 b.71.1.2 (A:1-77,A:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]} arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik dpavgfletispgysihtylwhrq
Timeline for d1ogsa1: