SCOP 1.65: Domain d1ogsa1: 1ogs A:1-77,A:432-497

Lineage for d1ogsa1 (1ogs A:1-77,A:432-497)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.2: Glucosylceramidase composite domain [89388] (1 protein)
   interrupted by the catalytic domain; the N-terminal region wraps around the C-terminal core similar to the alpha-amylase domain

6. Protein Glucosylceramidase composite domain [89389] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89390] (1 PDB entry)

8. Domain d1ogsa1: 1ogs A:1-77,A:432-497 [86997]
   Other proteins in same PDB: d1ogsa2, d1ogsb2

Details for d1ogsa1

PDB Entry: 1ogs, 2 Å

PDB Description: human acid-beta-glucosidase

SCOP Domain Sequences for d1ogsa1:

Sequence; same for both SEQRES and ATOM records:

>d1ogsa1 b.71.1.2 (A:1-77,A:432-497) Glucosylceramidase composite domain {Human (Homo sapiens)}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

Timeline for d1ogsa1:

• d1ogsa1 is new in SCOP 1.65
  
• d1ogsa1 appears in SCOP 1.67
  
• d1ogsa1 appears in the current release, SCOPe 2.08