Lineage for d1oghb_ (1ogh B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568126Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 568241Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 568242Family b.85.4.1: dUTPase-like [51284] (3 proteins)
  6. 568243Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species)
    elaborated fold with additional structures
  7. 568244Species Archaeon Methanococcus jannaschii [TaxId:2190] [89426] (4 PDB entries)
    synonym: Methanocaldococcus jannaschii
  8. 568248Domain d1oghb_: 1ogh B: [86995]

Details for d1oghb_

PDB Entry: 1ogh (more details), 1.88 Å

PDB Description: structure of the bifunctional dctp deaminase-dutpase from methanocaldococcus jannaschii

SCOP Domain Sequences for d1oghb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oghb_ b.85.4.1 (B:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii}
milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
k

SCOP Domain Coordinates for d1oghb_:

Click to download the PDB-style file with coordinates for d1oghb_.
(The format of our PDB-style files is described here.)

Timeline for d1oghb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ogha_