Class b: All beta proteins [48724] (144 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (1 family) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (2 proteins) |
Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species) elaborated fold with additional structures |
Species Archaeon Methanococcus jannaschii [TaxId:2190] [89426] (4 PDB entries) synonym: Methanocaldococcus jannaschii |
Domain d1oghb_: 1ogh B: [86995] |
PDB Entry: 1ogh (more details), 1.88 Å
SCOP Domain Sequences for d1oghb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oghb_ b.85.4.1 (B:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii} milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser k
Timeline for d1oghb_: