Lineage for d1ogha_ (1ogh A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678502Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 678503Family b.85.4.1: dUTPase-like [51284] (4 proteins)
  6. 678504Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species)
    elaborated fold with additional structures
  7. 678505Species Archaeon Methanococcus jannaschii [TaxId:2190] [89426] (4 PDB entries)
    synonym: Methanocaldococcus jannaschii
  8. 678508Domain d1ogha_: 1ogh A: [86994]

Details for d1ogha_

PDB Entry: 1ogh (more details), 1.88 Å

PDB Description: structure of the bifunctional dctp deaminase-dutpase from methanocaldococcus jannaschii
PDB Compounds: (A:) bifunctional deaminase/diphosphatase

SCOP Domain Sequences for d1ogha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]}
milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadv

SCOP Domain Coordinates for d1ogha_:

Click to download the PDB-style file with coordinates for d1ogha_.
(The format of our PDB-style files is described here.)

Timeline for d1ogha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oghb_