Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries) |
Domain d1ogae2: 1oga E:119-245 [86993] Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab_, d1ogad1, d1ogae1 |
PDB Entry: 1oga (more details), 1.4 Å
SCOP Domain Sequences for d1ogae2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae awgradq
Timeline for d1ogae2: