Lineage for d1ogae2 (1oga E:119-245)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786857Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 786858Domain d1ogae2: 1oga E:119-245 [86993]
    Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab_, d1ogad1, d1ogae1

Details for d1ogae2

PDB Entry: 1oga (more details), 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.
PDB Compounds: (E:) T-cell receptor beta chain c region

SCOP Domain Sequences for d1ogae2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgradq

SCOP Domain Coordinates for d1ogae2:

Click to download the PDB-style file with coordinates for d1ogae2.
(The format of our PDB-style files is described here.)

Timeline for d1ogae2: