| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (24 PDB entries) |
| Domain d1ogad2: 1oga D:118-202 [86991] Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab1, d1ogab2, d1ogad1, d1ogae1 |
PDB Entry: 1oga (more details), 1.4 Å
SCOPe Domain Sequences for d1ogad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogad2 b.1.1.2 (D:118-202) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsavaws
nksdfacanafnnsiipedtffpsp
Timeline for d1ogad2: