Lineage for d1ogad2 (1oga D:118-202)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749669Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2749670Domain d1ogad2: 1oga D:118-202 [86991]
    Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab1, d1ogab2, d1ogad1, d1ogae1, d1ogae3
    missing some secondary structures that made up less than one-third of the common domain

Details for d1ogad2

PDB Entry: 1oga (more details), 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.
PDB Compounds: (D:) T-cell receptor alpha chain v region

SCOPe Domain Sequences for d1ogad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogad2 b.1.1.2 (D:118-202) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsavaws
nksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d1ogad2:

Click to download the PDB-style file with coordinates for d1ogad2.
(The format of our PDB-style files is described here.)

Timeline for d1ogad2: