Lineage for d1ogad1 (1oga D:3-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023718Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2023719Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
  8. 2023720Domain d1ogad1: 1oga D:3-117 [86990]
    Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab1, d1ogab2, d1ogad2, d1ogae2

Details for d1ogad1

PDB Entry: 1oga (more details), 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.
PDB Compounds: (D:) T-cell receptor alpha chain v region

SCOPe Domain Sequences for d1ogad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qlleqspqflsiqegenltvycnsssvfsslqwyrqepgegpvllvtvvtggevkklkrl
tfqfgdarkdsslhitaaqpgdtglylcagagsqgnlifgkgtklsvkpniqnpd

SCOPe Domain Coordinates for d1ogad1:

Click to download the PDB-style file with coordinates for d1ogad1.
(The format of our PDB-style files is described here.)

Timeline for d1ogad1: