SCOP 1.65: Domain d1ogad1: 1oga D:3-117

Lineage for d1ogad1 (1oga D:3-117)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (10 PDB entries)

8. Domain d1ogad1: 1oga D:3-117 [86990]
   Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab_, d1ogad2, d1ogae2

Details for d1ogad1

PDB Entry: 1oga, 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.

SCOP Domain Sequences for d1ogad1:

Sequence; same for both SEQRES and ATOM records:

>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
qlleqspqflsiqegenltvycnsssvfsslqwyrqepgegpvllvtvvtggevkklkrl
tfqfgdarkdsslhitaaqpgdtglylcagagsqgnlifgkgtklsvkpniqnpd

Timeline for d1ogad1:

• d1ogad1 is new in SCOP 1.65
  
• d1ogad1 appears in SCOP 1.67
  
• d1ogad1 appears in the current release, SCOPe 2.08