SCOP 1.71: Domain d1ogaa1: 1oga A:182-276

Lineage for d1ogaa1 (1oga A:182-276)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Class I MHC, alpha-3 domain [88604] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88605] (76 PDB entries)
Domain d1ogaa1: 1oga A:182-276 [86987]
Other proteins in same PDB: d1ogaa2, d1ogab_, d1ogad1, d1ogad2, d1ogae1, d1ogae2

Details for d1ogaa1

PDB Entry: 1oga (more details), 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.

SCOP Domain Sequences for d1ogaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogaa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1ogaa1:

Click to download the PDB-style file with coordinates for d1ogaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ogaa1: