Lineage for d1ogaa1 (1oga A:182-276)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288747Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 288748Species Human (Homo sapiens) [TaxId:9606] [88605] (56 PDB entries)
  8. 288751Domain d1ogaa1: 1oga A:182-276 [86987]
    Other proteins in same PDB: d1ogaa2, d1ogab_, d1ogad1, d1ogad2, d1ogae1, d1ogae2

Details for d1ogaa1

PDB Entry: 1oga (more details), 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.

SCOP Domain Sequences for d1ogaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogaa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1ogaa1:

Click to download the PDB-style file with coordinates for d1ogaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ogaa1: