Lineage for d1og6a_ (1og6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2092401Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2092402Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2092628Protein Hypothetical oxidoreductase YdhF [89459] (1 species)
  7. 2092629Species Escherichia coli [TaxId:562] [89460] (2 PDB entries)
  8. 2092631Domain d1og6a_: 1og6 A: [86984]
    complexed with nap

Details for d1og6a_

PDB Entry: 1og6 (more details), 2.8 Å

PDB Description: ydhf, an aldo-keto reductase from e.coli complexed with nadph
PDB Compounds: (A:) hypothetical oxidoreductase ydhf

SCOPe Domain Sequences for d1og6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1og6a_ c.1.7.1 (A:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]}
lvqritiapqgpefsrfvmgywrlmdwnmsarqlvsfieehldlgvttvdhadiyggyqc
eaafgealklaphlrermeivskcgiattareenvighyitdrdhiiksaeqslinlatd
hldlllihrpdplmdadevadafkhlhqsgkvrhfgvsnftpaqfallqsrlpftlatnq
veispvhqpllldgtldqlqqlrvrpmawsclgggrlfnddyfqplrdelavvaeelnag
sieqvvnawvlrlpsqplpiigsgkiervraaveaetlkmtrqqwfrirkaalgydvp

SCOPe Domain Coordinates for d1og6a_:

Click to download the PDB-style file with coordinates for d1og6a_.
(The format of our PDB-style files is described here.)

Timeline for d1og6a_: