Lineage for d1ofza_ (1ofz A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2399004Superfamily b.68.8: Fucose-specific lectin [89372] (2 families) (S)
    automatically mapped to Pfam PF07938
  5. 2399005Family b.68.8.1: Fucose-specific lectin [89373] (2 protein domains)
  6. 2399006Protein Fucose-specific lectin [89374] (1 species)
  7. 2399007Species Orange peel mushroom (Aleuria aurantia) [TaxId:5188] [89375] (3 PDB entries)
  8. 2399008Domain d1ofza_: 1ofz A: [86978]
    complexed with fuc, ful

Details for d1ofza_

PDB Entry: 1ofz (more details), 1.5 Å

PDB Description: crystal structure of fungal lectin: six-bladed beta-propeller fold and novel fucose recognition mode for aleuria aurantia lectin
PDB Compounds: (A:) fucose-specific lectin

SCOPe Domain Sequences for d1ofza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofza_ b.68.8.1 (A:) Fucose-specific lectin {Orange peel mushroom (Aleuria aurantia) [TaxId: 5188]}
pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklf
splaavtwksaqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqw
ggsesappnirvyyqksnlsgssiheyvwsgkwtagasfgstapgtgigataigpgrlri
yyqatdnkirehcwdsnswyvggfsasasagvsiaaiswgstpnirvywqkgreelyeaa
yggswntpgqikdasrptpslpdtfiaanssgnidisvffqasgvslqqwqwisgkgwsi
gavvptgtpagw

SCOPe Domain Coordinates for d1ofza_:

Click to download the PDB-style file with coordinates for d1ofza_.
(The format of our PDB-style files is described here.)

Timeline for d1ofza_: