Lineage for d1ofuy_ (1ofu Y:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597855Family c.37.1.22: Bacterial cell division inhibitor SulA [89678] (1 protein)
    homologous to RecA but lacks its P-loop motif; the fold is C-terminally truncated; 5-stranded parallel beta-sheet, order: 15423
  6. 1597856Protein Hypothetical protein PA3008 [89679] (1 species)
  7. 1597857Species Pseudomonas aeruginosa [TaxId:287] [89680] (2 PDB entries)
  8. 1597859Domain d1ofuy_: 1ofu Y: [86977]
    Other proteins in same PDB: d1ofua1, d1ofua2, d1ofub1, d1ofub2
    complexed with FtsZ
    complexed with gdp

Details for d1ofuy_

PDB Entry: 1ofu (more details), 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa
PDB Compounds: (Y:) hypothetical protein pa3008

SCOPe Domain Sequences for d1ofuy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofuy_ c.37.1.22 (Y:) Hypothetical protein PA3008 {Pseudomonas aeruginosa [TaxId: 287]}
paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri
lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg

SCOPe Domain Coordinates for d1ofuy_:

Click to download the PDB-style file with coordinates for d1ofuy_.
(The format of our PDB-style files is described here.)

Timeline for d1ofuy_: