![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.22: Bacterial cell division inhibitor SulA [89678] (1 protein) homologous to RecA but lacks its P-loop motif; the fold is C-terminally truncated; 5-stranded parallel beta-sheet, order: 15423 |
![]() | Protein Hypothetical protein PA3008 [89679] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [89680] (2 PDB entries) |
![]() | Domain d1ofux_: 1ofu X: [86976] Other proteins in same PDB: d1ofua1, d1ofua2, d1ofub1, d1ofub2 |
PDB Entry: 1ofu (more details), 2.1 Å
SCOP Domain Sequences for d1ofux_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofux_ c.37.1.22 (X:) Hypothetical protein PA3008 {Pseudomonas aeruginosa [TaxId: 287]} paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg
Timeline for d1ofux_: