![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [52492] (9 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [89639] (2 PDB entries) |
![]() | Domain d1ofub1: 1ofu B:11-208 [86974] Other proteins in same PDB: d1ofua2, d1ofub2, d1ofux_, d1ofuy_ complexed with SulA homologue PA3008 complexed with gdp |
PDB Entry: 1ofu (more details), 2.1 Å
SCOPe Domain Sequences for d1ofub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofub1 c.32.1.1 (B:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl agavrgisdiikrpgmin
Timeline for d1ofub1:
![]() Domains from other chains: (mouse over for more information) d1ofua1, d1ofua2, d1ofux_, d1ofuy_ |