Lineage for d1ofub1 (1ofu B:11-208)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483277Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 483278Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 483279Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 483280Protein Cell-division protein FtsZ [52492] (3 species)
  7. 483290Species Pseudomonas aeruginosa [TaxId:287] [89639] (1 PDB entry)
  8. 483292Domain d1ofub1: 1ofu B:11-208 [86974]
    Other proteins in same PDB: d1ofua2, d1ofub2, d1ofux_, d1ofuy_
    complexed with SulA homologue PA3008

Details for d1ofub1

PDB Entry: 1ofu (more details), 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa

SCOP Domain Sequences for d1ofub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofub1 c.32.1.1 (B:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa}
tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg
aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva
vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl
agavrgisdiikrpgmin

SCOP Domain Coordinates for d1ofub1:

Click to download the PDB-style file with coordinates for d1ofub1.
(The format of our PDB-style files is described here.)

Timeline for d1ofub1: