Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.32: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52490] (2 families) |
Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins) |
Protein Cell-division protein FtsZ [52492] (2 species) |
Species Pseudomonas aeruginosa [TaxId:287] [89639] (1 PDB entry) |
Domain d1ofub1: 1ofu B:11-208 [86974] Other proteins in same PDB: d1ofua2, d1ofub2, d1ofux_, d1ofuy_ complexed with SulA homologue PA3008 complexed with gdp |
PDB Entry: 1ofu (more details), 2.1 Å
SCOP Domain Sequences for d1ofub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofub1 c.32.1.1 (B:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa} tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl agavrgisdiikrpgmin
Timeline for d1ofub1:
View in 3D Domains from other chains: (mouse over for more information) d1ofua1, d1ofua2, d1ofux_, d1ofuy_ |