SCOPe 2.08: Domain d1ofub1: 1ofu B:11-208

Lineage for d1ofub1 (1ofu B:11-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [89639] (2 PDB entries)

8. Domain d1ofub1: 1ofu B:11-208 [86974]
   Other proteins in same PDB: d1ofua2, d1ofub2, d1ofux_, d1ofuy_
   complexed with SulA homologue PA3008
   complexed with gdp

Details for d1ofub1

PDB Entry: 1ofu, 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d1ofub1:

Sequence; same for both SEQRES and ATOM records:

>d1ofub1 c.32.1.1 (B:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg
aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva
vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl
agavrgisdiikrpgmin

Timeline for d1ofub1:

• d1ofub1 first appeared in SCOP 1.65
  
• d1ofub1 appears in SCOPe 2.07