Lineage for d1ofua2 (1ofu A:209-317)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727435Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 727436Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 727437Protein Cell-division protein FtsZ [55309] (4 species)
  7. 727463Species Pseudomonas aeruginosa [TaxId:287] [89982] (1 PDB entry)
  8. 727464Domain d1ofua2: 1ofu A:209-317 [86973]
    Other proteins in same PDB: d1ofua1, d1ofub1, d1ofux_, d1ofuy_

Details for d1ofua2

PDB Entry: 1ofu (more details), 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa
PDB Compounds: (A:) cell division protein ftsz

SCOP Domain Sequences for d1ofua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofua2 d.79.2.1 (A:209-317) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
vdfadvktvmsemgmammgtgcasgpnrareateaairnplledvnlqgargilvnitag
pdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvtvvatglg

SCOP Domain Coordinates for d1ofua2:

Click to download the PDB-style file with coordinates for d1ofua2.
(The format of our PDB-style files is described here.)

Timeline for d1ofua2: