SCOP 1.65: Domain d1ofua2: 1ofu A:209-317

Lineage for d1ofua2 (1ofu A:209-317)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin/Dihydroxyacetone kinase C-terminal domain [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Cell-division protein FtsZ [55309] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [89982] (1 PDB entry)

8. Domain d1ofua2: 1ofu A:209-317 [86973]
   Other proteins in same PDB: d1ofua1, d1ofub1, d1ofux_, d1ofuy_

Details for d1ofua2

PDB Entry: 1ofu, 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa

SCOP Domain Sequences for d1ofua2:

Sequence; same for both SEQRES and ATOM records:

>d1ofua2 d.79.2.1 (A:209-317) Cell-division protein FtsZ {Pseudomonas aeruginosa}
vdfadvktvmsemgmammgtgcasgpnrareateaairnplledvnlqgargilvnitag
pdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvtvvatglg

Timeline for d1ofua2:

• d1ofua2 is new in SCOP 1.65
  
• d1ofua2 appears in SCOP 1.67
  
• d1ofua2 appears in the current release, SCOPe 2.08