Lineage for d1ofua1 (1ofu A:11-208)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694479Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 694480Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 694481Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 694482Protein Cell-division protein FtsZ [52492] (4 species)
  7. 694508Species Pseudomonas aeruginosa [TaxId:287] [89639] (1 PDB entry)
  8. 694509Domain d1ofua1: 1ofu A:11-208 [86972]
    Other proteins in same PDB: d1ofua2, d1ofub2, d1ofux_, d1ofuy_

Details for d1ofua1

PDB Entry: 1ofu (more details), 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa
PDB Compounds: (A:) cell division protein ftsz

SCOP Domain Sequences for d1ofua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg
aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva
vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl
agavrgisdiikrpgmin

SCOP Domain Coordinates for d1ofua1:

Click to download the PDB-style file with coordinates for d1ofua1.
(The format of our PDB-style files is described here.)

Timeline for d1ofua1: