SCOP 1.69: Domain d1ofua1: 1ofu A:11-208

Lineage for d1ofua1 (1ofu A:11-208)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)

6. Protein Cell-division protein FtsZ [52492] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [89639] (1 PDB entry)

8. Domain d1ofua1: 1ofu A:11-208 [86972]
   Other proteins in same PDB: d1ofua2, d1ofub2, d1ofux_, d1ofuy_

Details for d1ofua1

PDB Entry: 1ofu, 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa

SCOP Domain Sequences for d1ofua1:

Sequence; same for both SEQRES and ATOM records:

>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa}
tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg
aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva
vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl
agavrgisdiikrpgmin

Timeline for d1ofua1:

• d1ofua1 first appeared in SCOP 1.65
  
• d1ofua1 appears in SCOP 1.67
  
• d1ofua1 appears in SCOP 1.71
  
• d1ofua1 appears in the current release, SCOPe 2.08