Lineage for d1ofs.2 (1ofs C:,D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778650Species Pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 2778654Domain d1ofs.2: 1ofs C:,D: [86967]
    complexed with ca, mn

Details for d1ofs.2

PDB Entry: 1ofs (more details), 1.8 Å

PDB Description: pea lectin-sucrose complex
PDB Compounds: (C:) pea lectin alpha chain, (D:) pea lectin beta chain

SCOPe Domain Sequences for d1ofs.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ofs.2 b.29.1.1 (C:,D:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nsXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsg

SCOPe Domain Coordinates for d1ofs.2:

Click to download the PDB-style file with coordinates for d1ofs.2.
(The format of our PDB-style files is described here.)

Timeline for d1ofs.2: