Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein HslV (ClpQ) protease [56258] (3 species) dodecameric prokaryotic homologue of proteasome |
Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries) |
Domain d1ofim_: 1ofi M: [86964] Other proteins in same PDB: d1ofia_, d1ofib_, d1ofic_ |
PDB Entry: 1ofi (more details), 3.2 Å
SCOP Domain Sequences for d1ofim_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofim_ d.153.1.4 (M:) HslV (ClpQ) protease {Haemophilus influenzae} ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
Timeline for d1ofim_: