Lineage for d1ofii_ (1ofi I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224776Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 2224840Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 2224867Domain d1ofii_: 1ofi I: [86962]
    Other proteins in same PDB: d1ofia_, d1ofib_, d1ofic_
    complexed with adp, lvs, mg, po4

Details for d1ofii_

PDB Entry: 1ofi (more details), 3.2 Å

PDB Description: asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
PDB Compounds: (I:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1ofii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofii_ d.153.1.4 (I:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn

SCOPe Domain Coordinates for d1ofii_:

Click to download the PDB-style file with coordinates for d1ofii_.
(The format of our PDB-style files is described here.)

Timeline for d1ofii_: