Lineage for d1ofih_ (1ofi H:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1044730Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1044782Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 1044808Domain d1ofih_: 1ofi H: [86961]
    Other proteins in same PDB: d1ofia_, d1ofib_, d1ofic_
    complexed with adp, lvs, mg, po4

Details for d1ofih_

PDB Entry: 1ofi (more details), 3.2 Å

PDB Description: asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
PDB Compounds: (H:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1ofih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofih_ d.153.1.4 (H:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn

SCOPe Domain Coordinates for d1ofih_:

Click to download the PDB-style file with coordinates for d1ofih_.
(The format of our PDB-style files is described here.)

Timeline for d1ofih_: