Lineage for d1ofih_ (1ofi H:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419895Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 419896Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 420035Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 420036Protein HslV (ClpQ) protease [56258] (3 species)
    dodecameric prokaryotic homologue of proteasome
  7. 420073Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 420087Domain d1ofih_: 1ofi H: [86961]
    Other proteins in same PDB: d1ofia_, d1ofib_, d1ofic_

Details for d1ofih_

PDB Entry: 1ofi (more details), 3.2 Å

PDB Description: asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)

SCOP Domain Sequences for d1ofih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofih_ d.153.1.4 (H:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn

SCOP Domain Coordinates for d1ofih_:

Click to download the PDB-style file with coordinates for d1ofih_.
(The format of our PDB-style files is described here.)

Timeline for d1ofih_: